Esta buscando: G+Biosciences

Proveedor: G-Biosciences

Descripción: GenLysates™ are total protein tissue and cell lysates that are extracted from the tissue or cell of interest. To inhibit proteolysis, the GenLysates™ are prepared in a lysis buffer containing a complete protease inhibitor cocktail. Each lysate lot is tested by electrophoresis and Western blot analysis.

Proveedor: G-Biosciences

Descripción: FOCUS™ PhosphoRich™ is a ready-to-use kit that enriches phosphorylated proteins and phosphopeptides from complex biological samples. The kit contains spin columns that have a phosphoprotein binding resin with a binding capacity of ~20 mg phosphorylated ovalbumin per column. The resin columns supplied with the kit can be reused, if regenerated and stored properly. FOCUS™ PhosphoRich™ is suitable for 2D gel electrophoresis and for proteomics and cell signalling studies.

Numero del catalogo: (DGA01)

Proveedor: G-Biosciences

Descripción: The 'critical micelle concentration' (CMC) of a detergent varies with temperature, pH, ionic strength, detergent concentration, purity and presence of organic agents in the detergent. Using a large excess of detergent may pose problems during purification procedures or other downstream applications.

UOM: 1 * 500 UN

Promoción

Numero del catalogo: (DG051)

Proveedor: G-Biosciences

Descripción: 3-[(3-Colamidopropil)-dimetilamonio]-propano sulfonato (CHAPS)

UOM: 1 * 25 g

Promoción

Numero del catalogo: (786-PSB)

Proveedor: G-Biosciences

Descripción: FOCUS™ protein solubilisation buffer is a dry, urea-based buffer for protein solubilisation. It is a pre-mixed formulation of urea, thiourea, CHAPS and non detergent sulphobetaine for maximum solubilising strength.

UOM: 1 * 50 mL

Promoción

Proveedor: G-Biosciences

Descripción: G-Biosciences offers 0.9% NaCl in two convenient sizes to meet your particular laboratory needs. These sterile saline solutions are suitable for numerous applications.

FDS Certificados

Proveedor: Tonbo Biosciences

Descripción: The 2.4G2 antibody is specific for a common epitope found in the extracellular regions of mouse Fc-receptors Fc-gamma II (CD32) and Fc-gamma III (CD16). These receptors are expressed by B cells, monocytes, macrophages, NK cells, dendritic cells, and neutrophils.

Numero del catalogo: (786-325)

Proveedor: G-Biosciences

Descripción: ProteSEEKER™ identifies specific types of proteases with a panel of twelve protease inhibitors and a sensitive colorimetric protease screening assay. ProteSEEKER™ allows researchers to screen their protein samples and establish which specific class of proteases are present and therefore design a highly specific protease inhibitor cocktail using the minimal number of protease inhibitors. Alternatively, ProteSEEKER™ can be used to test existing protease inhibitor cocktails and identify their inadequacies and therefore supplement in additional protease inhibitors.

UOM: 1 * 50 Assays

Promoción

Numero del catalogo: (786-802)

Proveedor: G-Biosciences

Descripción: The Pearl™ Monoclonal IgG Purification Kit allows for the rapid purification of antibodies from cell culture supernatant and ascites fluid. The Pearl™ IgG purification resin binds the high abundant, non-IgG proteins (i.e. albumin) and allows the IgG molecules to pass through in a physiological buffer. The IgG molecules can be stored or used in downstream applications without further clean-up, such as ammonium sulphate precipitation.

UOM: 1 * 1 KIT

Promoción

Proveedor: Tonbo Biosciences

Descripción: The MP4-25D2 antibody is specific for human IL-4, a pleiotropic cytokine that Th2 cell differentiation, B cell proliferation and differentiation, and B cell class switching to IgE. MP4-25D2 is a neutralizing antibody and is reported to cross react with rhesus monkey IL-4.

Proveedor: G-Biosciences

Descripción: FirstChoice™ Blocking Buffer is ideal as a first choice for optimization of new assays and systems, or when determining the optimal blocking buffer for elimination of non specific binding sites in ELISA, blotting, immunohistochemistry and other applications. Buffers are conveniently supplied in widely used TBS (Tris-buffered saline at pH 7,5) and PBS (phosphate-buffered saline at pH 7,5) buffers as well as in separate formulations containing Tween® 20 for improving blocking efficiencies.

Proveedor: Biotium

Descripción: This product is prepared by labeling highly cross-adsorbed goat anti-rat IgG (H+L) with the dye CF™770. CF™770 is one of our three outstanding near-IR CF™ dyes developed by Biotium. Near-IR CF™ dyes are superior to other similar near-IR dyes, such as IRDye® 800CW and the DyLight® 800. Near-IR CF™ dyes have combined advantages in brightness, photostability, specificity and novel features ideal for in vivo imaging, near-IR Western blotting and flow cytometry. To minimize crossreactivity, the antibody has been adsorbed against human, bovine, horse, and rabbit serum proteins.

DyLight® is a registered trademark of Thermo Fisher Scientific. IRDye® is a registered trademark of LI-COR® Bioscience.

Numero del catalogo: (DG097)

Proveedor: G-Biosciences

Descripción: 3-[(3-Colamidopropil)-dimetilamonio]-propano sulfonato (CHAPS) 5% en solución acuosa

UOM: 1 * 50 mL

Promoción

Numero del catalogo: (COBSD3-1866-50)

Proveedor: Columbia Biosciences

Descripción: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))

UOM: 1 * 50 µG

Promoción

Proveedor: G-Biosciences

Descripción: Nickel chelating resin is an immobilised metal affinity chromatography (IMAC) resin that was specifically designed to utilise Ni²⁺ for the purification of nickel binding proteins, including 6x histidine tagged proteins.

Numero del catalogo: (733-1945)

Proveedor: G-Biosciences

Descripción: A ready to use, 100X concentrated, broad range protease inhibitor cocktail that is fully compatible with 2D electrophoresis and subsequent mass spectrometry.

UOM: 1 * 1 mL

Certificados Promoción