Esta buscando: (4-Aminofenil)acetato+de+etilo

Proveedor: Tonbo Biosciences

Descripción: The L17F12 antibody is specific for human CD5, a 67 kD transmembrane glycoprotein that is expressed on most thymocytes, mature T cells, and a subset of B cells. CD5 is a member of the scavenger receptor superfamily and is present on approximately 70% of normal peripheral blood lymphocytes. CD5 is involved in modulating antigen receptor signaling in both T and B cells and acts through binding of CD72, its receptor expressed on B cells.

Proveedor: Tonbo Biosciences

Descripción: The HIT2 antibody is specific for human CD38, a 45 kD type II transmembrane glycoprotein expressed on thymocytes, activated T and B cells, and monocytes as well as other non-hematopoietic cells. CD38 is an ectoenzyme that functions to catalyze the synthesis and hydrolysis of cyclic ADP-ribose and is involved in cell signaling, regulating cell adhesion, and activation. Additionally, CD38 has been shown to be a prognostic marker for some leukemias and other diseases.

Proveedor: G-Biosciences

Descripción: These CL (Compatible Lowry) Protein Assay is based on the widely cited protein assay by Lowry et. al. (1951). The CL Protein Assay improves upon the traditional Lowry method to be compatible with common laboratory agents known to interfere with Lowry protein assays such as reducing agents (dithiothreitol (DTT), ß-mercaptoethanol and TCEP), detergents, chelating agents, amines, sugars, strong chaotropic buffers, salts, drugs, antibiotics, cobalt and other common laboratory agents.

Proveedor: Tonbo Biosciences

Descripción: The XMG1.2 antibody is specific for mouse Interferon-gamma (IFN-g), a 20 kDa type II cytokine known for its central roles in protection against bacterial or viral pathogens and for its anti-tumor properties. IFN-g is secreted by several types of immune cells which allow the cytokine to modulate innate immunity when secreted by NK and NKT cells, and to function in support of adaptive immunity when secreted by Th1 and CD8+ T cells (CTLs).

Proveedor: Tonbo Biosciences

Descripción: The RM134L antibody recognizes CD252, also known as OX-40 Ligand or CD134 Ligand, a member of the TNF superfamily that is present on the surface of antigen presenting cells and activated B lymphocytes. The OX-40 Ligand interacts with OX-40 (CD134) which is expressed primarily on activated T cells. This costimulatory interaction leads to increased proliferation and IL-2 production responses of activated T cells, and at the same time enhances proliferation and immunoglobulin secretion by activated B cells.

Proveedor: Tonbo Biosciences

Descripción: The XMG1.2 antibody is specific for mouse Interferon-gamma (IFN-g), a 20 kDa type II cytokine known for its central roles in protection against bacterial or viral pathogens and for its anti-tumor properties. IFN-g is secreted by several types of immune cells, which allow the cytokine to modulate innate immunity, when secreted by NK and NKT cells, and to function in supporting adaptive immunity when secreted by Th1 and CD8+ T cells (CTLs).

Numero del catalogo: (DG097)

Proveedor: G-Biosciences

Descripción: 3-[(3-Colamidopropil)-dimetilamonio]-propano sulfonato (CHAPS) 5% en solución acuosa

UOM: 1 * 50 mL

Promoción

Numero del catalogo: (COBSD3-1866-50)

Proveedor: Columbia Biosciences

Descripción: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))

UOM: 1 * 50 µG

Promoción

Proveedor: G-Biosciences

Descripción: Protein-S-S-Reductant™ uses TCEP (Tris [2-carboxyethyl] phosphine), a popular alternative to β-mercaptoethanol and DTT (dithiothreitol). TCEP improves stability, increases effectiveness, and reduces proteins over a wider range of pH, including lower acidic pHs. Protein-S-S-Reductant™ completely reduces stable disulfide bonds in less than 5 minutes at room temperature and is compatible with the protein alkylation reactions. This ready to use solution is at a neutral pH and stabilised for long-term storage. Simply supplement Protein-S-S-Reductant™ in place of DTT or β-mercaptoethanol and boil the sample.

Numero del catalogo: (GENO786-1906)

Proveedor: G-Biosciences

Descripción: <p>Immobilised Catalase is prepared by covalent coupling of catalase enzyme to 6% cross-linked agarose beads. Immobilised Catalase is used to remove hydrogen peroxide from biological samples for use in downstream applications which require absenceof hydrogen peroxide as it causes interference.</p> <p> </p>

UOM: 1 * 2 mL

New Product Promoción

Numero del catalogo: (BE-104)

Proveedor: G-Biosciences

Descripción: This DNA fingerprinting kit allows students to carry out their own criminal investigation by comparing DNA samples collected from suspects to DNA collected at a pseudo-crime scene.

UOM: 1 * 1 KIT

Promoción

Numero del catalogo: (QEDB35103)

Proveedor: QED Bioscience

Descripción: Anti-Insulin Growth Factor-1 Receptor (IGF-1R) Mouse Monoclonal Antibody

UOM: 1 * 100 µG

Promoción

Proveedor: Tonbo Biosciences

Descripción: The 1A8 antibody binds to mouse Ly-6G, commonly known as Gr-1, a member of the Ly-6 superfamily of GPI-anchored cell surface proteins with roles in cell signaling and cell adhesion. Gr-1 is differentially expressed during development and maturation of cells in the myeloid lineage and is expression at varying stages and levels on monocytes, macrophages, granulocytes, and peripheral neutrophils.

Proveedor: Tonbo Biosciences

Descripción: The RB6-8C5 antibody binds to mouse Ly-6G, commonly known as Gr-1, a member of the Ly-6 superfamily of GPI-anchored cell surface proteins with roles in cell signaling and cell adhesion. Gr-1 is differentially expressed during development and maturation of cells in the myeloid lineage and is expression at varying stages and levels on monocytes, macrophages, granulocytes, and peripheral neutrophils.

Numero del catalogo: (QEDB16402)

Proveedor: QED Bioscience

Descripción: Anti-Phenobarbital Mouse Monoclonal Antibody

UOM: 1 * 500 µG

Promoción

Numero del catalogo: (QEDB16907)

Proveedor: QED Bioscience

Descripción: Anti-N-Acetylprocainamide Mouse Monoclonal Antibody

UOM: 1 * 500 µG

Promoción