Imprimir…

Esta buscando: OZ+BIOSCIENCES


23 233  results were found

Refinar resultados Ordenado por
SearchResultCount:"23233"

Sort Results

Vista lista Vista Extendida (Nueva)

Valore los resultados de su búsqueda

Product Image-786-246

Proteome kits, mammalian proteome, FOCUS™

Numero del catalogo: (786-246)
Proveedor: G-Biosciences
Descripción: Extracts and solubilises nearly all of the proteins from mammalian samples, including membrane as well as soluble proteins, by a strong chaotropic extraction buffer to solubilise even the most difficult proteins. Suitable for biological samples from animal tissues and adherent and suspension cells.
UOM: 1 * 1 KIT
Product Image-786-305

Western blot stripping buffer, Western ReProbe™

Proveedor: G-Biosciences
Descripción: Western ReProbe™ is a single component system that is specifically formulated to dissociate and remove antibodies from membrane-bound proteins without destroying the antigenic binding affinity. Western ReProbe™ also enables the ability to reuse Western blots.

Product Image-786-283

Protein A and G Antibody Purification Kits

Proveedor: G-Biosciences
Descripción: Immobilised Protein A and G are designed for binding the constant domains of immunoglobulin (Ig) molecules. Immobilised Protein A is coupled to 6% highly cross-linked agarose beads by a proprietary coupling method that provides high coupling efficiency for immunoglobulins and minimal protein A leaching. The binding capacity of Protein A is 18 to 43 mg Human IgG per ml resin.

Product Image-786-892

Bicinchoninic acid (BCA) reducing agent compatible protein Assay

Proveedor: G-Biosciences
Descripción: The Bicinchoninic Acid (BCA) Protein Assay is a highly sensitive colorimetric assay that is compatible with detergent solubilised protein solutions, however is dramatically affected by the presence of reducing agents, including DTT, ß-mercaptoethanol and TCEP.

Certificados

Image Unavailable-786-288

Dry buffer packs, JAW™

Proveedor: G-Biosciences
Descripción: Premixed buffer powders that simply require adding water to generate a ready-to-use buffer.

Certificados

Product Image-PL-06

Lysates, plant tissue GenLysate™

Proveedor: G-Biosciences
Descripción: GenLysates™ are total protein tissue and cell lysates that are extracted from the tissue or cell of interest. To inhibit proteolysis, the GenLysates™ are prepared in a lysis buffer containing a complete protease inhibitor cocktail. Each lysate lot is tested by electrophoresis and Western blot analysis.

Image Unavailable-COBSD9-1310

Anti-schistosomal Glutathione-S-Transferase Goat Polyclonal Antibody (DyLight® 550)

Numero del catalogo: (COBSD9-1310)
Proveedor: Columbia Biosciences
Descripción: Anti-schistosomal Glutathione-S-Transferase Goat Polyclonal Antibody (DyLight® 550)
UOM: 1 * 100 µG
Image Unavailable-30-8057-U500

Anti-IgG Goat Polyclonal Antibody (Biotin)

Numero del catalogo: (30-8057-U500)
Proveedor: Tonbo Biosciences
Descripción: Goat anti-Mouse IgG (H&L) - F(ab')2 fragment, Biotin Conjugate, min x w/bovine, goat, human, rabbit, or rat IgG
UOM: 1 * 0,5 mg
Product Image-786-190T

Non-animal protein blocking Agent, NAP-BLOCKER™

Proveedor: G-Biosciences
Descripción: NAP-BLOCKER™ is an animal-free protein blocking agent recommended for improved assay sensitivity, minimal non specific binding and a high signal-to-background ratio. It is suitable for Western blots, dot blots and assay development.

Image Unavailable-30-8027-M001

Anti-IgE Goat Polyclonal Antibody (Biotin)

Numero del catalogo: (30-8027-M001)
Proveedor: Tonbo Biosciences
Descripción: Goat anti-Human IgE (epsilon chain) - Affinity Pure, Biotin Conjugate, min x w/bovine, mouse or rabbit serum proteins
UOM: 1 * 1 mg
Image Unavailable-35-8075-M001

Anti-IgM (µ chain) Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Numero del catalogo: (35-8075-M001)
Proveedor: Tonbo Biosciences
Descripción: Rabbit anti-Human IgM (mu chain) - Affinity Pure, FITC Conjugate
UOM: 1 * 1 mg
Product Image-TB25

Western blots, pre-made, human single tissue single species

Proveedor: G-Biosciences
Descripción: Ready-to-screen, human, single tissue blots, from both normal and tumour tissues. G-Biosciences pre-made blots are prepared with the appropriate GenLysate™ and 50 μg protein is loaded onto a 4 to 20% denaturing polyacrylamide gel, along with a prestained molecular weight marker. After the proteins are resolved, they are transferred to a PVDF membrane, using our Western transfer buffer.

Product Image-786-387

femtoCHROMO™- HRP Substrate for chromogenic detection

Proveedor: G-Biosciences
Descripción: A ready to use modified TMB (3, 3’, 5, 5’-Tetramethylbenzidine) substrate is used that generates a dark blue precipitate in the presence of horseradish peroxidase.

Image Unavailable-COBSD3-1866-50

Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))

Numero del catalogo: (COBSD3-1866-50)
Proveedor: Columbia Biosciences
Descripción: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 50 µG
Image Unavailable-DG097

3-[(3-Colamidopropil)-dimetilamonio]-propano sulfonato (CHAPS) 5% en solución acuosa

Numero del catalogo: (DG097)
Proveedor: G-Biosciences
Descripción: 3-[(3-Colamidopropil)-dimetilamonio]-propano sulfonato (CHAPS) 5% en solución acuosa
UOM: 1 * 50 mL
Image Unavailable-COBSD3-1714-100

Anti-c-Myc tag Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: 9E10]

Numero del catalogo: (COBSD3-1714-100)
Proveedor: Columbia Biosciences
Descripción: Anti-c-Myc tag Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: 9E10]
UOM: 1 * 100 µG
Consulta de precio
El stock para este material es limitada pero puede estar disponible en un almacén cerca de usted. Por favor, asegúrese de que ha iniciado sesión en la web para que el stock disponible se puede mostrar. Si el call sigue apareciendo y usted necesita ayuda, por favor llámenos al 902 222 897 o por email en webshop.es@avantorsciences.com.
El stock para este material es limitada pero puede estar disponible en un almacén cerca de usted. Por favor, asegúrese de que ha iniciado sesión en la web para que el stock disponible se puede mostrar. Si el call sigue apareciendo y usted necesita ayuda, por favor llámenos al 902 222 897 o por email en webshop.es@avantorsciences.com.
Este producto se trata de un artículo regulado sometido a normativa que restringe su venta. Si procede, nos pondremos en contacto con usted para solicitarle la licencia o declaración de uso necesaria para poder proceder al suministro del producto.
Este producto se trata de un artículo regulado sometido a normativa que restringe su venta.
Si procede, nos pondremos en contacto con usted para solicitarle la licencia o declaración de uso necesaria para poder proceder al suministro del producto.
Este producto ha sido bloqueado por su organización. Por favor, pónganse en contacto con su departamento de compras para obtener más información.
El producto original ya no está disponible. Su sustituto se muestra a continuación.
El producto(s) marcados con este símbolo están descatalogados - se venden hasta acabar stock. Pueden encontrar alternativas buscando con el número de catálogo VWR listado arriba. Si necesita más ayuda, por favor llame al Servicio de atención al cliente de VWR al 902.222.897.
209 - 224 of 23 233
no targeter for Bottom